PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000884.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family HB-PHD
Protein Properties Length: 839aa    MW: 93243.5 Da    PI: 4.6943
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000884.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.5e-08695737345
                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
                 Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                              ++ ++ ++ +++L e F++n+yp++e +e LA++lgLt +qV+
  Itr_sc000884.1_g00004.1 695 TKSRYGEDVIKRLFESFKENQYPKREVKESLATELGLTAQQVS 737
                              6677888999*******************************96 PP

2PHD37.93.9e-13368422150
                              SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                      PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCke 50 
                              +C+ Cg+    ++++++lCdg C++ fH+ Cl+++l +e++p g   wlC+ C +
  Itr_sc000884.1_g00004.1 368 FCAKCGSkdLPADNDIILCDGaCERGFHQFCLEPPLLKEDIPPGdeVWLCPGCVC 422
                              699***966566********66********************99999******87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.98E-15357427IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.106.7E-13365423IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.843366423IPR019787Zinc finger, PHD-finger
CDDcd155042.05E-25368420No hitNo description
PfamPF006281.2E-10368422IPR019787Zinc finger, PHD-finger
SMARTSM002492.1E-9368421IPR001965Zinc finger, PHD-type
PROSITE patternPS013590369420IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.604.5E-9685737IPR009057Homeodomain-like
SuperFamilySSF466891.45E-6688737IPR009057Homeodomain-like
PROSITE profilePS500718.956690736IPR001356Homeobox domain
SMARTSM003890.0076692746IPR001356Homeobox domain
CDDcd000862.58E-6693738No hitNo description
PfamPF000461.3E-5695737IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MATNSNCGSL GPNSTEYDHQ NANAKLVERI ELPHENGAAN SLVGYSANPR IELPLERDAM  60
DSNQQHKKPE LENCDVNSDV GEMTLPPGFE TANSTVGYSS QLPNKVTGNL CPQQLKETHT  120
YAIGNPSGTL MRRNENNEKQ AEMPSKHKFL RPPLEDLTLN LRSKNVEFPP ENERAYSVAD  180
PAEPPGFESH NRGHRLRGTC KDANKSPAQL EHEEKGHPES ISTSRTDVNT TRVLRPKTHK  240
QSESPIPNDA AAGDSDDGKN NRTRRKEKQK KQNAVNEFSS IRTKLRYLLH RIKYEQNLID  300
AYSGEGWKGK SIEKIKPEKE LQRAKSGIFT YKLKIRDLFQ RIDMMLAHGR LPESSFDSKG  360
LIDSEDIFCA KCGSKDLPAD NDIILCDGAC ERGFHQFCLE PPLLKEDIPP GDEVWLCPGC  420
VCKLDCFVLL NDLLGTNLSL PDSWEKVFPE EAASVVSGKK LDDVSGLPSD DSEDDDYNPD  480
HPEVEENGSG DESASEESDY FSASDDLAAP VNNDQPTGLP SDDSEDDDYD PDAPDHDAQV  540
MQESSNSDFT SDSEDVGPEV NDTRTPSQDQ CGETKIGGVV QHSLNDELSY QQSNDDLVSQ  600
KRYGEGLDYK KSNDEAHQST SSDYCDEEYG CTAPKRKNRS RKAAHKSSDQ AAMAVMNTNF  660
NQSETEHTTE RRSRKRLKVE GSVTPEQGSS SKKNTKSRYG EDVIKRLFES FKENQYPKRE  720
VKESLATELG LTAQQVSKCA KLFMPWGCHT EPPSASLDKE ECQSVMIRYG FKDPEVTEAE  780
DAMQNCGRSI TKSVNDLKTS TGRFPRVTRT GISIISAYPT NTDMYLLDAT SSSPGEVID
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775281.11e-170PREDICTED: pathogenesis-related homeodomain protein
RefseqXP_009775282.11e-170PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487861e-128PRH_PETCR; Pathogenesis-related homeodomain protein
TrEMBLA0A0V0IXY31e-160A0A0V0IXY3_SOLCH; Putative pathogenesis-related homeodomain protein-like
STRINGSolyc01g107410.2.11e-154(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72202126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-78Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain